![Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining in human gallbladder and skeletal muscle tissues using anti-PLXNB1 antibody. Corresponding PLXNB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Plexin-B1-Antibody-Immunohistochemistry-Paraffin-NBP1-87782-img0006.jpg "Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining in human gallbladder and skeletal muscle tissues using anti-PLXNB1 antibody. Corresponding PLXNB1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLXNB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLXNB1 |
![Western Blot: Plexin B1 Antibody [NBP1-87782] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/Plexin-B1-Antibody-Western-Blot-NBP1-87782-img0004.jpg "Western Blot: Plexin B1 Antibody [NBP1-87782] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4")
![Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Plexin-B1-Antibody-Immunohistochemistry-Paraffin-NBP1-87782-img0010.jpg "Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human gall bladder shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Plexin-B1-Antibody-Immunohistochemistry-NBP1-87782-img0003.jpg "Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human gall bladder shows strong cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human fallopian tube shows moderate cytoplasmic/ membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Plexin-B1-Antibody-Immunohistochemistry-Paraffin-NBP1-87782-img0008.jpg "Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human fallopian tube shows moderate cytoplasmic/ membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and moderate membranous/ cytoplasmic positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/Plexin-B1-Antibody-Immunohistochemistry-Paraffin-NBP1-87782-img0009.jpg "Immunohistochemistry-Paraffin: Plexin B1 Antibody [NBP1-87782] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and moderate membranous/ cytoplasmic positivity in cells in glomeruli.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![Flow Cytometry Semaphorin 4D/CD100 Antibody [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_4D_AF5235_Flow_Cytometry_8267.jpg)
![Immunohistochemistry Semaphorin 4D/CD100 Antibody [Unconjugated]](https://images.novusbio.com/images2/Semaphorin_4D_AF5235_Immunohistochemistry_24184.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry_6480.jpg)
![Immunohistochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunohistochemistry_22376.jpg)
![Immunocytochemistry S100A9 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A9_AF2065_Immunocytochemistry__Immunofluorescence_22492.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")