PCBP1 Antibody (7M1K0) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PCBP1 (Q15365). MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
PCBP1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PCBP1 Antibody (7M1K0)
Background
PCBP1 is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for PCBP1 Antibody (NBP3-15734) (0)
There are no publications for PCBP1 Antibody (NBP3-15734).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PCBP1 Antibody (NBP3-15734) (0)
There are no reviews for PCBP1 Antibody (NBP3-15734).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PCBP1 Antibody (NBP3-15734) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PCBP1 Products
Research Areas for PCBP1 Antibody (NBP3-15734)
Find related products by research area.
|
Blogs on PCBP1