Novus Biologicals products are now on bio-techne.com

p120-catenin Recombinant Protein Antigen

Images

 
There are currently no images for p120-catenin Protein (NBP2-38130PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

p120-catenin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTNND1.

Source: E. coli

Amino Acid Sequence: ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTNND1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38130.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p120-catenin Recombinant Protein Antigen

  • Cadherin-associated Src substrate
  • CAS
  • catenin (cadherin-associated protein), delta 1
  • catenin delta-1
  • CTNND
  • KIAA0384P120CAS
  • p120 catenin
  • p120
  • p120(CAS)
  • p120(CTN)
  • p120cas
  • p120ctn

Background

The alpha, beta, delta, and gamma -catenins are proteins that bind to the highly conserved, intracellular cytoplasmic tail of E-cadherin. Together, the catenin/cadherin complexes play an important role mediating cellular adhesion. alpha-catenin, a 102 kDa protein, interacts with E-cadherin associated protein, and also associates with other members of the cadherin family, such as N-cadherin and P-cadherin. The 92 kDa beta-catenin associates with the cytoplasmic portion of E-cadherin, which is necessary for the function of E-cadherin as an adhesion molecule. beta-catenin also complexes with the tumor suppressor protein APC. delta-catenin interacts with Presenilin 1 and is expressed in the brain. The gene encoding delta-catenin maps to human chromosome 5p15.2. A hemizygous loss of the gene encoding delta-catenin leads to the mental retardation associated with Cri-du-Chat syndrome. gamma-catenin, also known as plakoglobin, is an 80-88 kDa protein that binds alpha-catenin and N-cadherin. In addition, the transmembrane phosphatase PTPm associates with catenin/cadherin complexes and may regulate complex signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34594
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
AF4478
Species: Hu
Applications: IHC, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
H00009221-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38206
Species: Hu
Applications: IHC, IHC-P, KD, WB
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
NB100-1699
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Publications for p120-catenin Protein (NBP2-38130PEP) (0)

There are no publications for p120-catenin Protein (NBP2-38130PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p120-catenin Protein (NBP2-38130PEP) (0)

There are no reviews for p120-catenin Protein (NBP2-38130PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p120-catenin Protein (NBP2-38130PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p120-catenin Products

Research Areas for p120-catenin Protein (NBP2-38130PEP)

Find related products by research area.

Blogs on p120-catenin

There are no specific blogs for p120-catenin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p120-catenin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNND1