Home » NT5C3 » NT5C3 Proteins » NT5C3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NT5C3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NT5C3 Protein (NBP2-38124PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NT5C3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NT5C3.

Source: E. coli

Amino Acid Sequence: FDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NT5C3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38124.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NT5C3 Recombinant Protein Antigen

  • 5'-nucleotidase, cytosolic III
  • cN-IIIMGC87828
  • cytosolic 5'-nucleotidase 3
  • Cytosolic 5'-nucleotidase III
  • p36
  • P5N1
  • P5N-1
  • P5'N-1MGC27337
  • PN-IMGC87109
  • PSN1UMPH
  • Pyrimidine 5'-nucleotidase 1
  • UMPH1EC 3.1.3.5
  • uridine 5' monophosphate hydrolase 1
  • Uridine 5'-monophosphate hydrolase 1

Background

Plasmid: pCMV-NT5C3 Full length; Host Cell: 293T

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Annexin A2
Antibody (1G7)
H00000302-M02
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Western Blot Annexin A2 Antibody (1G7)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
S100A10 Antibody
[Unconjugated]
AF2377
Western Blot S100A10 Antibody [Unconjugated]
Immunohistochemistry S100A10 Antibody [Unconjugated]
Simple Western S100A10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
P11 Antibody
NBP1-82458
Immunohistochemistry-Paraffin P11 Antibody
Immunohistochemistry-Paraffin P11 Antibody
Immunohistochemistry-Paraffin P11 Antibody
Species: Hu
Applications: IHC, IHC-P
Exosome component
6 Antibody
NBP1-57508
Western Blot Exosome component 6 Antibody
Immunohistochemistry-Paraffin Exosome component 6 Antibody
Immunohistochemistry-Paraffin Exosome component 6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/ Immunofluorescence CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Annexin A1
Antibody [Unconjugate
AF3770
Western Blot Annexin A1 Antibody [Unconjugated]
Immunohistochemistry Annexin A1 Antibody [Unconjugated]
Simple Western Annexin A1 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Cyclin H Antibody
(1B8)
H00000902-M01
Western Blot Cyclin H Antibody (1B8)
Immunocytochemistry/ Immunofluorescence Cyclin H Antibody (1B8)
Immunohistochemistry-Paraffin Cyclin H Antibody (1B8)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
HABP1/C1QBP/GC1q R
Antibody
NBP1-89790
Western Blot HABP1/C1QBP/GC1q R Antibody
Immunohistochemistry-Paraffin HABP1/C1QBP/GC1q R Antibody
Immunohistochemistry-Paraffin HABP1/C1QBP/GC1q R Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin Calcium-binding-protein-P22 Antibody
Immunocytochemistry/ Immunofluorescence Calcium-binding-protein-P22 Antibody
Immunohistochemistry-Paraffin Calcium-binding-protein-P22 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
CDCA5 Antibody
NBP1-89530
Western Blot CDCA5 Antibody
Immunohistochemistry-Paraffin CDCA5 Antibody
Immunocytochemistry/ Immunofluorescence CDCA5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Ficolin-2 Antibody
AF2428
Ficolin-2 Antibody
Species: Hu
Applications: WB
Uroplakin IIIB
Antibody
NBP1-92564
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GCHFR Antibody
(846011) [Unconjugate
MAB7918
Simple Western GCHFR Antibody (846011) [Unconjugated]
Western Blot GCHFR Antibody (846011) [Unconjugated]
Species: Hu
Applications: Simple Western, WB
IL-12
[Unconjugated]
419-ML
SDS-PAGE IL-12 [Unconjugated]
Bioactivity IL-12 [Unconjugated]
(267 Publications)
Species: Mu
Applications: BA
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for NT5C3 Protein (NBP2-38124PEP) (0)

There are no publications for NT5C3 Protein (NBP2-38124PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5C3 Protein (NBP2-38124PEP) (0)

There are no reviews for NT5C3 Protein (NBP2-38124PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NT5C3 Protein (NBP2-38124PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NT5C3 Products

Blogs on NT5C3

There are no specific blogs for NT5C3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NT5C3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NT5C3A