IL-17RA/IL-17R Antibody (6Q2U9) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 767-866 of human IL-17RA/IL-17R (Q96F46). GCSRPAMVLTDPHTPYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQRQLLFRQLQKNSGWDTMGSESEGPSA |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
IL17RA |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 -1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for IL-17RA/IL-17R Antibody (6Q2U9)
Background
IL17RA is a gene that codes for a widely expressed protein that functions as a receptor for IL17A (a proinflammatory cytokine secreted by T-lymphocytes) with low affinity, which suggests that additional components are necessary to induce signaling and has a length of 866 amino acids and a weight of approximately 96 kDa. Current studies are being done on several diseases and disorders related to this gene including rheumatoid arthritis, cat eye syndrome, candidiasis, pituitary adenoma, bronchiolitis, cystic fibrosis, Sjogren's syndrome, keratitis, myocarditis, hepatitis B, liver disease, gingivitis, and osteoarthritis. IL17RA has also been shown to have interactions with IL17F, IL17RE, UBC, and TRAF3IP2 in pathways such as the IL-21 signaling, NF-kappaB signaling, and cytokine production pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, ICFlow, WB
Publications for IL-17RA/IL-17R Antibody (NBP3-16577) (0)
There are no publications for IL-17RA/IL-17R Antibody (NBP3-16577).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-17RA/IL-17R Antibody (NBP3-16577) (0)
There are no reviews for IL-17RA/IL-17R Antibody (NBP3-16577).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-17RA/IL-17R Antibody (NBP3-16577) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-17RA/IL-17R Products
Research Areas for IL-17RA/IL-17R Antibody (NBP3-16577)
Find related products by research area.
|
Blogs on IL-17RA/IL-17R