Home » Hormone-sensitive Lipase/HSL » Hormone-sensitive Lipase/HSL Proteins » Hormone-sensitive Lipase/HSL Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Hormone-sensitive Lipase/HSL Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Hormone-sensitive Lipase/HSL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Hormone-sensitive Lipase/HSL.

Source: E. coli

Amino Acid Sequence: HLLHKSRYVASNRRSIFFRTSHNLAELEAYLAALTQLRALVYYAQRLLVTNRPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLVSFGEHYKRNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIPE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58889.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen

  • hormone-sensitive lipase testicular isoform
  • Hormonesensitive Lipase
  • Hormone-sensitive Lipase
  • HSL
  • HSLEC 3.1.1.79
  • LHS
  • lipase, hormone-sensitive
  • LIPE

Background

Hormone-sensitive lipase (HSL) is an intracellular neutral lipase found in a variety of tissues, but primarily in adipose and steroidogenic tissues. It hydrolyzes triglycerides into free fatty acids and cholesteryl esters into free cholesterol for steroid hormone synthesis.

HSL is the major enzyme responsible for the mobilization of free fatty acids from adopise tissue, and HSL antibodies are useful tools for lipid and metabolism research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Carboxyl Ester
Lipase/CEL Antibody
NBP1-88502
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Species: Hu
Applications: IHC, IHC-P
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
PEDFR/PNPLA2/ATGL
Antibody [Unconjugate ...
AF5365
Western Blot PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
Simple Western PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
Immunohistochemistry PEDFR/PNPLA2/ATGL Antibody [Unconjugated]
(10 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Plastin L Antibody
NBP2-19860
Immunocytochemistry/ Immunofluorescence Plastin L Antibody
Western Blot Plastin L Antibody
Immunocytochemistry/ Immunofluorescence Plastin L Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Perilipin Antibody
NB110-40760
Flow Cytometry Perilipin Antibody
Flow Cytometry Perilipin Antibody
Imaging Mass Cytometry Perilipin Antibody
(1 Review)
(16 Publications)
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC, IHC-P, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody
Western Blot Fatty Acid Synthase/FASN Antibody
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody
(2 Reviews)
(27 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(810 Publications)
Species: Hu
Applications: BA
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Carboxylesterase
1/CES1 Antibody
NBP1-85691
Simple Western Carboxylesterase 1/CES1 Antibody
Simple Western Carboxylesterase 1/CES1 Antibody
Western Blot Carboxylesterase 1/CES1 Antibody
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(184 Publications)
Species: Hu
Applications: ELISA
FABP4/A-FABP
Antibody [Unconjugate
AF1443
Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]
Western Blot FABP4/A-FABP Antibody [Unconjugated]
Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]
(2 Reviews)
(39 Publications)
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB

Publications for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP) (0)

There are no publications for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP) (0)

There are no reviews for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hormone-sensitive Lipase/HSL Products

Research Areas for Hormone-sensitive Lipase/HSL Recombinant Protein Antigen (NBP2-58889PEP)

Find related products by research area.

Blogs on Hormone-sensitive Lipase/HSL

There are no specific blogs for Hormone-sensitive Lipase/HSL, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hormone-sensitive Lipase/HSL Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LIPE