Home » HES-1 » HES-1 Proteins » Recombinant Human HES-1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human HES-1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

100% Guarantee on every product

Recombinant Human HES-1 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 277 of Human HES1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HES1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
55.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HES-1 GST (N-Term) Protein

  • BHLHB39
  • bHLHb39hairy homolog (Drosophila)
  • Class B basic helix-loop-helix protein 39
  • FLJ20408
  • Hairy and enhancer of split 1
  • hairy and enhancer of split 1, (Drosophila)
  • Hairy homolog
  • Hairy-like protein
  • HES1
  • HES-1
  • hHL
  • HL
  • HRY
  • HRYHHL
  • transcription factor HES-1

Background

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
LIPC Antibody -
BSA Free
NBP3-04922
Immunocytochemistry/ Immunofluorescence LIPC Antibody - BSA Free
Species: Hu
Applications: ICC/IF, WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Knockout Validated Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Plastin L Antibody
NBP2-19860
Western Blot Plastin L Antibody
Western Blot Plastin L Antibody
Immunocytochemistry/ Immunofluorescence Plastin L Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP) csl/RBPJK Antibody
Western Blot csl/RBPJK Antibody
Immunocytochemistry/ Immunofluorescence csl/RBPJK Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ChIP, ICC/IF, WB
CETP Antibody
(ATM192) - BSA Free
NB300-558
Immunocytochemistry/ Immunofluorescence CETP Antibody (ATM192) - BSA Free
Western Blot CETP Antibody (ATM192) - BSA Free
(1 Publication)
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
HES5 Antibody -
BSA Free
NBP2-41305
Immunocytochemistry/ Immunofluorescence HES5 Antibody - BSA Free
Western Blot HES5 Antibody - BSA Free
Immunohistochemistry-Paraffin HES5 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Recombinant Human
Fucosyltransferase 1/ ...
H00002523-P01
Other Recombinant Human Fucosyltransferase 1/FUT1 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
ASCL1/Mash1
Antibody [Unconjugate
AF2567
Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
HFE Antibody (1G12)
H00003077-M01
Western Blot HFE Antibody (1G12)
Immunocytochemistry/ Immunofluorescence HFE Antibody (1G12)
Western Blot HFE Antibody (1G12)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(20 Publications)
Species: Hu
Applications: BA
Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Notch-4 Antibody
[Unconjugated]
AF3847
Immunocytochemistry Notch-4 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
ABR Antibody
NBP1-30981
Immunocytochemistry/ Immunofluorescence ABR Antibody
Western Blot ABR Antibody
Western Blot ABR Antibody
Species: Hu, Mu
Applications: ICC/IF, WB
SGPL1 Antibody
[Unconjugated]
AF5535
Western Blot SGPL1 Antibody [Unconjugated]
Simple Western SGPL1 Antibody [Unconjugated]
(14 Publications)
Species: Hu
Applications: Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(22 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for HES-1 Recombinant Protein (H00003280-P01) (0)

There are no publications for HES-1 Recombinant Protein (H00003280-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HES-1 Recombinant Protein (H00003280-P01) (0)

There are no reviews for HES-1 Recombinant Protein (H00003280-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HES-1 Recombinant Protein (H00003280-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HES-1 Products

Research Areas for HES-1 Recombinant Protein (H00003280-P01)

Find related products by research area.

Blogs on HES-1

There are no specific blogs for HES-1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: Notch-1 Antibody (mN1A) [NB100-78486] - Analysis of FFPE human pancreatic cancer using 1:10 dilution of Notch-1 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic staining in epithelial cells was observed. Staining was performed by Histowiz.
Notch-1 Antibody (mN1A) - BSA Free
NB100-78486

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HES-1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol HES1