![Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Analysis in human testis and skeletal muscle tissues using NBP2-38556 antibody. Corresponding GTF2H1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GTF2H1-Antibody-Immunohistochemistry-Paraffin-NBP2-38556-img0012.jpg "Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Analysis in human testis and skeletal muscle tissues using NBP2-38556 antibody. Corresponding GTF2H1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYN |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GTF2H1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot DOK1 [p Tyr362] Antibody](https://images.novusbio.com/images/DOK1-[p-Tyr362]-Antibody-Western-Blot-NB100-82112-img0001.jpg)
![Immunohistochemistry-Paraffin DOK1 [p Tyr362] Antibody](https://images.novusbio.com/images/DOK1-[p-Tyr362]-Antibody-Immunohistochemistry-Paraffin-NB100-82112-img0002.jpg)
![Western Blot DOK1 [p Tyr362] Antibody](https://images.novusbio.com/images/DOK1-[p-Tyr362]-Antibody-Western-Blot-NB100-82112-img0004.jpg)
| Publication using NBP2-38556 | Applications | Species |
|---|---|---|
| van Toorn M, Turkyilmaz Y, Han S et al. Active DNA damage eviction by HLTF stimulates nucleotide excision repair Molecular cell 2022-03-04 [PMID: 35271816] |
Secondary Antibodies |
Isotype Controls |
Research Areas for GTF2H1 Antibody (NBP2-38556)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody [NBP2-38556] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GTF2H1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38556-img0004.jpg "Immunocytochemistry/Immunofluorescence: GTF2H1 Antibody [NBP2-38556] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human skeletal muscle shows no nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/GTF2H1-Antibody-Immunohistochemistry-Paraffin-NBP2-38556-img0015.jpg "Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human skeletal muscle shows no nuclear positivity in myocytes.")
![Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/GTF2H1-Antibody-Immunohistochemistry-Paraffin-NBP2-38556-img0010.jpg "Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/GTF2H1-Antibody-Immunohistochemistry-Paraffin-NBP2-38556-img0013.jpg "Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/GTF2H1-Antibody-Immunohistochemistry-Paraffin-NBP2-38556-img0014.jpg "Immunohistochemistry-Paraffin: GTF2H1 Antibody [NBP2-38556] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.")
![Western Blot: GTF2H1 Antibody [NBP2-38556] - Analysis in human cell line U-2197.](http://images.novusbio.com/fullsize/antibody/nbp2-38556_rabbit-polyclonal-gtf2h1-antibody-western-blot-184202410189..jpg "Western Blot: GTF2H1 Antibody [NBP2-38556] - Analysis in human cell line U-2197.")
![Western Blot DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Western_Blot_16723.jpg)
![Simple Western DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_17635.jpg)
![Immunohistochemistry DDR1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDR1_AF2396_Immunohistochemistry_7152.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")