![SDS-Page: Recombinant Human Glut4 Protein [H00006517-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00006517-Q01-1.jpg "SDS-Page: Recombinant Human Glut4 Protein [H00006517-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, PAGE, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 467-509 of Human Glut4 Source: Wheat Germ (in vitro) Amino Acid Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | SLC2A4 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 30.47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Research Areas for Glut4 Partial Recombinant Protein (H00006517-Q01)Find related products by research area.
|
|
Glucose Transporter 4 (GLUT4, SLC2A4) GLUT4 is an insulin-sensitive glucose transporter that facilitates insulin-stimulated glucose uptake in adipose tissue, skeletal muscle, and cardiac tissues that specifically express this protein. It is a twelve transmembrane domain multi-pass protein... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC2A4 |
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Flow Cytometry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Flow_Cytometry_19979.jpg)
![Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Immunocytochemistry__Immunofluorescence_20431.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_beta_1_AF2854_Western_Blot_5220.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023124938.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023125022.jpg)
![Immunocytochemistry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Immunohistochemistry_19084.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14781.jpg)
![Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]](https://images.novusbio.com/images2/TM4SF1_MAB8164_Flow_Cytometry_14884.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_812.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/DATA_Adiponectin_DRP300_ELISA_813.jpg)
![N/A Adiponectin/Acrp30 [HRP]](https://images.novusbio.com/images2/Adiponectin_DRP300_ELISA_173.jpg)
![Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.](https://images.novusbio.com/images/Glut4-Antibody-Flow-Intracellular-NBP1-49533-img0013.jpg "Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.")