I am looking for an ovine antibody for bFGF and PDGF-AB and ELISA Kits for both. It is for a research work on meniscus healing in sheep. Do you have anything suitable? How is the homology with sheep? Is it ever tested and/or published in papers?

Name: FGF basic/FGF2/bFGF Antibody (8W6M5)
Brand: Novus Biologicals
SKU: NBP3-15367
Price: 469 USD

Question

Accepted Answer

Unfortunately, most of the products you are interested in have not yet been tested in sheep, but this should not be a problem, due to sequence homology, and our Innovators Reward Program. In terms of an antibody for bFGF, also called FGF-2, we have several antibodies that are validated to detect the bovine protein, which is almost identical to that from sheep (99% homology). We only have FGF2 ELISA kits that have been tested with human or mouse. Mouse FGF-2 has 94% homology with sheep; human has 98% homology for most of its sequence, but also has an additional stretch of amino acids that is not present in the sheep protein. I therefore think that the mouse kit would be most suitable, just in case the human kit targets the region of the human protein not present in mouse. We sell antibodies to PDGF-A or PDGF-B rather than PDGF-AB. We don't have any PDGF-A antibodies that have been tested in sheep but there are several options you may find of interest. There isn't a sheep PDGFA sequence in UniProt, so I can't comment on how similar it is to the PDGFA from other species. Nevertheless, our  NBP1-52533 PDGFB antibody has been shown to work in sheep. We sell two PDGF-AB ELISA kits , but these are for human and rat. I'm not sure how well these would work with sheep. Note that if you test a product with a species (or application) that it has not yet been validated in, you are eligible for our Innovator's Reward: Novus would provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal or lesser value. You would email innovators@novusbio.com to apply for your award, and we

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, ICC/IF, IHC, KO
Clone	8W6M5
Clonality	Monoclonal
Host	Rabbit
Conjugate	Unconjugated

Additional Information	Recombinant Monoclonal Antibody
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF basic/FGF2/bFGF (NP_001997.5). RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
Isotype	IgG
Clonality	Monoclonal
Host	Rabbit
Gene	FGF2
Purity	Affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative	0.02% Sodium Azide
Purity	Affinity purified

FGF basic/FGF2/bFGF Antibody (8W6M5)

Species Glossary

Images

Product Details

Order Details

FGF basic/FGF2/bFGF Antibody (8W6M5) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for FGF basic/FGF2/bFGF Antibody (8W6M5)

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for FGF basic/FGF2/bFGF Antibody (NBP3-15367) (0)

Reviews for FGF basic/FGF2/bFGF Antibody (NBP3-15367) (0)

Product General Protocols

Video Protocols

FAQs for FGF basic/FGF2/bFGF Antibody (NBP3-15367). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional FGF basic/FGF2/bFGF Products

Research Areas for FGF basic/FGF2/bFGF Antibody (NBP3-15367)

Blogs on FGF basic/FGF2/bFGF

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics