Home » DNAI1 » DNAI1 Proteins » DNAI1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DNAI1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DNAI1 Protein (NBP1-84466PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

DNAI1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAI1.

Source: E. coli

Amino Acid Sequence: APHKQPHKQSISIGRGTRKRDEDSGTEVGEGTDEWAQSKATVRPPDQLELTDAELKEEFTRILTANNPHAPQNIVRYSFKEGTYKPIGFVNQLAVHYTQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84466.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAI1 Recombinant Protein Antigen

  • Axonemal dynein intermediate chain 1
  • CILD1MGC26204
  • dynein intermediate chain DNAI1
  • dynein, axonemal, intermediate chain 1
  • dynein, axonemal, intermediate polypeptide 1
  • ICS
  • ICS1
  • immotile cilia syndrome 1
  • PCDdynein intermediate chain 1, axonemal

Background

The inner- and outer-arm dyneins, which bridge between the doublet microtubules in axonemes, are the force-generatingproteins responsible for the sliding movement in axonemes. The intermediate and light chains, thought to form the baseof the dynein arm, help mediate attachment and may also participate in regulating dynein activity. This gene encodesan intermediate chain dynein, belonging to the large family of motor proteins. Mutations in this gene result inabnormal ciliary ultrastructure and function associated with primary ciliary dyskinesia (PCD) and Kartagener syndrome.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(383 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(23 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Bax Antibody
[Unconjugated]
AF820
Western Blot Bax Antibody [Unconjugated]
Immunocytochemistry Bax Antibody [Unconjugated]
Knockout Validated Bax Antibody [Unconjugated]
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(60 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Caspase-1 Antibody
(14F468) - BSA Free
NB100-56565
Immunohistochemistry-Paraffin Caspase-1 Antibody (14F468) - BSA Free
Western Blot Caspase-1 Antibody (14F468) - BSA Free
Western Blot Caspase-1 Antibody (14F468) - BSA Free
(69 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(369 Publications)
Species: Hu
Applications: BA
PCBD1 Antibody -
BSA Free
NBP2-93878
Western Blot PCBD1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PCBD1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(30 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Caspase-8 Antibody
NB100-56116
Western Blot Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
(2 Reviews)
(72 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Carboxylesterase
2/CES2 Antibody
NBP1-84556
Immunocytochemistry/ Immunofluorescence Carboxylesterase 2/CES2 Antibody
Immunohistochemistry-Paraffin Carboxylesterase 2/CES2 Antibody
Immunohistochemistry-Paraffin Carboxylesterase 2/CES2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AIF Antibody
[Unconjugated]
AF1457
Western Blot AIF Antibody [Unconjugated]
Simple Western AIF Antibody [Unconjugated]
Knockout Validated AIF Antibody [Unconjugated]
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Caspase-9 Antibody
NB100-56118
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
(1 Review)
(25 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for DNAI1 Protein (NBP1-84466PEP) (0)

There are no publications for DNAI1 Protein (NBP1-84466PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAI1 Protein (NBP1-84466PEP) (0)

There are no reviews for DNAI1 Protein (NBP1-84466PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAI1 Protein (NBP1-84466PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAI1 Products

Research Areas for DNAI1 Protein (NBP1-84466PEP)

Find related products by research area.

Blogs on DNAI1

There are no specific blogs for DNAI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAI1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DNAI1