Coagulation Factor II/Thrombin Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
F2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Coagulation Factor II/Thrombin Antibody
Background
Proteinase-activated receptor 3 (PAR3) is a member of the Proteinase-Activated Receptor subfamily. The enzyme thrombin is involved in the activation of platelets, leukocytes, endothelial cells, and mesenchymal cells at sites of vascular injury. These cellular responses are triggered through proteolytic activation of PAR3 and other receptors by thrombin. It is believed that PAR3 functions as a cofactor for the cleavage and activation of PAR4. PAR3 expression has been documented in blood, bone marrow, lung, spleen, and vessel. ESTs have been isolated from head/neck, skeletal muscle, and skin libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for Coagulation Factor II/Thrombin Antibody (NBP2-33728) (0)
There are no publications for Coagulation Factor II/Thrombin Antibody (NBP2-33728).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Coagulation Factor II/Thrombin Antibody (NBP2-33728) (0)
There are no reviews for Coagulation Factor II/Thrombin Antibody (NBP2-33728).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Coagulation Factor II/Thrombin Antibody (NBP2-33728). (Showing 1 - 1 of 1 FAQ).
-
Do you have neutralizing antibodies for anti-mouse Thrombin?
- We currently have 1 neutralizing Thrombin antibody (NBP1-95029), however it is an anti-human antibody and has only been validated in human samples. If you would like to test this antibody in mouse samples, you may be interested in participating in our Innovators Reward Program.
Secondary Antibodies
| |
Isotype Controls
|
Additional Coagulation Factor II/Thrombin Products
Research Areas for Coagulation Factor II/Thrombin Antibody (NBP2-33728)
Find related products by research area.
|
Blogs on Coagulation Factor II/Thrombin