![Western Blot: Caspase-6 Antibody [NBP1-87684] - Analysis using Anti-CASP6 antibody NBP1-87684 (A) shows similar pattern to independent antibody NBP1-87683 (B).](http://images.novusbio.com/fullsize/Caspase-6-Antibody-Western-Blot-NBP1-87684-img0008.jpg "Western Blot: Caspase-6 Antibody [NBP1-87684] - Analysis using Anti-CASP6 antibody NBP1-87684 (A) shows similar pattern to independent antibody NBP1-87683 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CASP6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Caspase-6 Antibody (NBP1-87684)Find related products by research area.
|
|
Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CASP6 |
![Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining in human small intestine and skeletal muscle tissues using anti-CASP6 antibody. Corresponding CASP6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Caspase-6-Antibody-Immunohistochemistry-Paraffin-NBP1-87684-img0007.jpg "Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining in human small intestine and skeletal muscle tissues using anti-CASP6 antibody. Corresponding CASP6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Caspase-6-Antibody-Immunohistochemistry-Paraffin-NBP1-87684-img0002.jpg "Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/Caspase-6-Antibody-Immunohistochemistry-Paraffin-NBP1-87684-img0005.jpg "Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/Caspase-6-Antibody-Immunohistochemistry-Paraffin-NBP1-87684-img0006.jpg "Immunohistochemistry-Paraffin: Caspase-6 Antibody [NBP1-87684] - Staining of human small intestine shows high expression.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")