![Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Western-Blot-NBP1-85922-img0009.jpg "Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CAPZB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CAPZB |
![Immunocytochemistry/Immunofluorescence: CAPZB Antibody [NBP1-85922] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85922-img0010.jpg "Immunocytochemistry/Immunofluorescence: CAPZB Antibody [NBP1-85922] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.")
![Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Immunohistochemistry-Paraffin-NBP1-85922-img0013.jpg "Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts and Leydig cells.")
![Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Western-Blot-NBP1-85922-img0008.jpg "Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in human cell line A-431.")
![Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Immunohistochemistry-Paraffin-NBP1-85922-img0002.jpg "Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Placenta shows strong cytoplasmic and membranous positivity in trophoblastic and decidual cells.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Immunohistochemistry-Paraffin-NBP1-85922-img0011.jpg "Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Placenta shows strong cytoplasmic and membranous positivity in trophoblastic and decidual cells.")
![Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Immunohistochemistry-Paraffin-NBP1-85922-img0012.jpg "Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Tonsil shows strong cytoplasmic and membranous positivity in germinal center and non-germinal center cells.](http://images.novusbio.com/fullsize/CAPZB-Antibody-Immunohistochemistry-Paraffin-NBP1-85922-img0014.jpg "Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Tonsil shows strong cytoplasmic and membranous positivity in germinal center and non-germinal center cells.")
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")