![Western Blot: CAP2 Antibody [NBP2-30572] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CAP2-Antibody-Western-Blot-NBP2-30572-img0001.jpg "Western Blot: CAP2 Antibody [NBP2-30572] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CAP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot FADD [p Ser194] Antibody (709736)](https://images.novusbio.com/images2/FADD_MAB7047_Western_Blot_11404.jpg)
![Immunocytochemistry FADD [p Ser194] Antibody (709736)](https://images.novusbio.com/images2/FADD_MAB7047_Immunocytochemistry_11450.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CAP2 Antibody (NBP2-30572)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: CAP2 Antibody [NBP2-30572] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30572-img0008.jpg "Immunocytochemistry/Immunofluorescence: CAP2 Antibody [NBP2-30572] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol.")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human testis.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0011.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human testis.")
![Immunohistochemistry: CAP2 Antibody [NBP2-30572] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-NBP2-30572-img0002.jpg "Immunohistochemistry: CAP2 Antibody [NBP2-30572] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0005.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0006.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining in human cerebral cortex and pancreas tissues using anti-CAP2 antibody. Corresponding CAP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0007.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining in human cerebral cortex and pancreas tissues using anti-CAP2 antibody. Corresponding CAP2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human cerebral cortex, heart muscle, kidney and testis using Anti-CAP2 antibody NBP2-30572 (A) shows similar protein distribution across tissues to independent antibody NBP2-30561 (B).](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0009.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human cerebral cortex, heart muscle, kidney and testis using Anti-CAP2 antibody NBP2-30572 (A) shows similar protein distribution across tissues to independent antibody NBP2-30561 (B).")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human heart muscle.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0010.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human heart muscle.")
![Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human kidney.](http://images.novusbio.com/fullsize/CAP2-Antibody-Immunohistochemistry-Paraffin-NBP2-30572-img0012.jpg "Immunohistochemistry-Paraffin: CAP2 Antibody [NBP2-30572] - Staining of human kidney.")
![Western Blot Prostasin/Prss8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostasin_AF4599_Western_Blot_20663.jpg)
![Simple Western Prostasin/Prss8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostasin_AF4599_Simple_Western_20980.jpg)
![Immunohistochemistry Prostasin/Prss8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostasin_AF4599_Immunohistochemistry_6839.jpg)
![Immunocytochemistry Glypican 3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glypican_3_AF2119_Immunocytochemistry__Immunofluorescence_20870.jpg)
![Immunohistochemistry Glypican 3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Glypican_3_AF2119_Immunohistochemistry_6734.jpg)
![Western Blot Glypican 3 Antibody [Unconjugated]](https://images.novusbio.com/images2/12878.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")