Home » ARHGAP20 » ARHGAP20 Proteins » ARHGAP20 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ARHGAP20 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ARHGAP20 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARHGAP20.

Source: E. coli

Amino Acid Sequence: STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARHGAP20
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56355.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARHGAP20 Recombinant Protein Antigen

  • KIAA1391Rho-type GTPase-activating protein 20
  • RA and RhoGAP domain containing protein
  • RARHOGAP
  • Rho GTPase activating protein 20
  • rho GTPase-activating protein 20

Background

The ARHGAP20 gene encodes for a Rho GTPase-activating protein 20 that does so by converting them to an inactive GDP-bound state. It exists in four isoforms: 1ad is 1,191 amino acids long at 132 kDA, 1be is 1,165 amino acids long at 130 kDA, 1c is 1,168 amino acids long at 130 kDA, and 1e(1d) is 1,155 amino acids long at nearly 129 kDA. ARHGAP20 participates is signal transduction and Rho GTPase cycle and interacts with various genes such as RHOA, GRB2, SIRT5, TERF2, and BMPR1B. ARHGAP20 has been researched in lymphocytic leukemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNF1LK2/SIK2
Antibody
NB100-56458
Western Blot SNF1LK2/SIK2 Antibody
(1 Publication)
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: WB
SRGAP2 Antibody
NBP1-88830
Immunocytochemistry/ Immunofluorescence SRGAP2 Antibody
Immunohistochemistry-Paraffin SRGAP2 Antibody
Immunohistochemistry-Paraffin SRGAP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SRGAP1 Antibody
(5D2)
H00057522-M03
Western Blot SRGAP1 Antibody (5D2)
Western Blot SRGAP1 Antibody (5D2)
ELISA SRGAP1 Antibody (5D2)
(2 Publications)
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
Ccd1/DIXDC1
Antibody [Unconjugate
AF5599
Western Blot Ccd1/DIXDC1 Antibody [Unconjugated]
Immunohistochemistry Ccd1/DIXDC1 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, WB
SRGAP3 Antibody
NBP1-88831
Western Blot SRGAP3 Antibody
Immunohistochemistry-Paraffin SRGAP3 Antibody
Immunohistochemistry-Paraffin SRGAP3 Antibody
(1 Publication)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ARHGAP1 Antibody
NBP1-85724
Immunocytochemistry/ Immunofluorescence ARHGAP1 Antibody
Western Blot ARHGAP1 Antibody
Immunohistochemistry ARHGAP1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
CHES1 Antibody
NBP2-38866
Immunohistochemistry-Paraffin CHES1 Antibody
Immunocytochemistry/ Immunofluorescence CHES1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BTG4 Antibody (1A6)
H00054766-M07
Western Blot BTG4 Antibody (1A6)
Immunocytochemistry/ Immunofluorescence BTG4 Antibody (1A6)
Species: Hu
Applications: ELISA, ICC/IF, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
SDHD Antibody -
BSA Free
NBP2-81948
Western Blot SDHD Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SDHD Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SDHD Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
TTC12 Antibody
NBP1-83693
Western Blot TTC12 Antibody
Immunohistochemistry-Paraffin TTC12 Antibody
Immunocytochemistry/ Immunofluorescence TTC12 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ARHGAP17 Antibody
NBP1-83870
Immunohistochemistry-Paraffin ARHGAP17 Antibody
Immunohistochemistry-Paraffin ARHGAP17 Antibody
Immunohistochemistry-Paraffin ARHGAP17 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
FOXN2 Antibody
NBP1-83153
Immunocytochemistry/ Immunofluorescence FOXN2 Antibody
Immunohistochemistry-Paraffin FOXN2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GRAF Antibody
NBP1-89732
Immunohistochemistry-Paraffin GRAF Antibody
Immunohistochemistry-Paraffin GRAF Antibody
Immunohistochemistry-Paraffin GRAF Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Chimaerin 2
Antibody
NBP3-12294
Immunohistochemistry-Paraffin Chimaerin 2 Antibody
Western Blot Chimaerin 2 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
CHN 1 Antibody
(OTI2G6)
NBP2-46290
Western Blot CHN 1 Antibody (OTI2G6)
Immunocytochemistry/ Immunofluorescence CHN 1 Antibody (OTI2G6)
Immunohistochemistry-Paraffin CHN 1 Antibody (OTI2G6)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ARHGAP23 Antibody
NBP1-93587
Immunocytochemistry/ Immunofluorescence ARHGAP23 Antibody
Species: Hu
Applications: ICC/IF
ARHGAP21 Antibody
NBP1-90852
Immunohistochemistry-Paraffin ARHGAP21 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP) (0)

There are no publications for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP) (0)

There are no reviews for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGAP20 Products

Research Areas for ARHGAP20 Recombinant Protein Antigen (NBP2-56355PEP)

Find related products by research area.

Blogs on ARHGAP20

There are no specific blogs for ARHGAP20, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Frozen: Rhodopsin Antibody (4D2) [NBP2-59690] - Zebrafish retina (outer nuclear layer). PFA and methanol fixed 7 um sections. Rhodopsin antibody O/N incubation at 1:500. IHC-Fr image submitted by a verified customer review.
Rhodopsin Antibody (4D2)
NBP2-59690-100ug

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARHGAP20 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ARHGAP20