![Western Blot: Annexin A2 Antibody [NBP1-59124] - Titration: 1.25ug/ml, Positive Control: Human Lung.](http://images.novusbio.com/fullsize/Annexin-A2-Antibody-Western-Blot-NBP1-59124-img0003.jpg "Western Blot: Annexin A2 Antibody [NBP1-59124] - Titration: 1.25ug/ml, Positive Control: Human Lung.")
| Reactivity | Hu, Mu, BvSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to ANXA2 (annexin A2) The peptide sequence was selected from the C terminal of ANXA2 (NP_004030). Peptide sequence: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ANXA2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Publication using NBP1-59124 | Applications | Species |
|---|---|---|
| Senthilkumaran C, Clark ME, Abdelaziz K et al. Increased annexin A1 and A2 levels in bronchoalveolar lavage fluid are associated with resistance to respiratory disease in beef calves. Vet Res 2013-04-08 [PMID: 23565988] (WB, Bovine) | WB | Bovine |
Secondary Antibodies |
Isotype Controls |
Research Areas for Annexin A2 Antibody (NBP1-59124)Find related products by research area.
|
|
Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax... Read full blog post. |
|
Integrin Beta 1/CD29 - a cell adhesion and cell signaling protein with diverse functions Integrins are a large family of trasmembrane proteins involved in cell adhesion and form a link between the intracellular cyskeletal proteins and extracellular matrix proteins. Integrins exist as heterodimers consisting of alpha and beta subunits. ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Annexin A2 Antibody [NBP1-59124] - Western blot of BALF samples labeled with antibody to annexin A2. Lane 1: synthetic annexin A1 peptide, 2: synthetic annexin A2 peptide (positive control), 3: molecular weight ladder, 4-6: samples from calves that remained healthy; 7-9: samples from calves that later developed pneumonia, 10: negative control. The two bands indicate that there are two isoforms of the annexin A2 present in BALF, and the density of the bands is higher in the calves that remained healthy compared to the calves that later developed pneumonia. Image collected and cropped by CiteAb from the following publication (//www.veterinaryresearch.org/content/44/1/24) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Annexin-A2-Antibody-Western-Blot-NBP1-59124-img0006.jpg "Western Blot: Annexin A2 Antibody [NBP1-59124] - Western blot of BALF samples labeled with antibody to annexin A2. Lane 1: synthetic annexin A1 peptide, 2: synthetic annexin A2 peptide (positive control), 3: molecular weight ladder, 4-6: samples from calves that remained healthy; 7-9: samples from calves that later developed pneumonia, 10: negative control. The two bands indicate that there are two isoforms of the annexin A2 present in BALF, and the density of the bands is higher in the calves that remained healthy compared to the calves that later developed pneumonia. Image collected and cropped by CiteAb from the following publication (//www.veterinaryresearch.org/content/44/1/24) licensed under a CC-BY license.")
![Western Blot: Annexin A2 Antibody [NBP1-59124] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/Annexin-A2-Antibody-Western-Blot-NBP1-59124-img0004.jpg "Western Blot: Annexin A2 Antibody [NBP1-59124] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml")
![Western Blot: Annexin A2 Antibody [NBP1-59124] - Lanes: Lane 1: 20 ug mouse GL261 cell lysate Lane 2: 20 ug mouse astrocyte cell lysate Primary Antibody Dilution: 1:250 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:500 Gene Name: ANXA2](http://images.novusbio.com/fullsize/Annexin-A2-Antibody-Western-Blot-NBP1-59124-img0005.jpg "Western Blot: Annexin A2 Antibody [NBP1-59124] - Lanes: Lane 1: 20 ug mouse GL261 cell lysate Lane 2: 20 ug mouse astrocyte cell lysate Primary Antibody Dilution: 1:250 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:500 Gene Name: ANXA2")
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/DATA_tPlasminogen_Activator_DTPA00_ELISA_854.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/tPlasminogen_Activator_DTPA00_ELISA_510.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")