![Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] - Staining in human gallbladder and skeletal muscle tissues using anti-PLD1 antibody. Corresponding PLD1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PLD1-Antibody-Immunohistochemistry-Paraffin-NBP2-34078-img0008.jpg "Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] - Staining in human gallbladder and skeletal muscle tissues using anti-PLD1 antibody. Corresponding PLD1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKFKHFQEFHR |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PLD1 Antibody (NBP2-34078)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PLD1 Antibody [NBP2-34078] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PLD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34078-img0006.jpg "Immunocytochemistry/Immunofluorescence: PLD1 Antibody [NBP2-34078] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/PLD1-Antibody-Immunohistochemistry-Paraffin-NBP2-34078-img0007.jpg "Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] - Staining of human gallbladder shows strong positivity in glandular cells.](http://images.novusbio.com/fullsize/PLD1-Antibody-Immunohistochemistry-NBP2-34078-img0004.jpg "Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] - Staining of human gallbladder shows strong positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] -Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-34078_rabbit-polyclonal-pld1-antibody-immunohistochemistry-paraffin-24920249260..jpg "Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] -Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-34078_rabbit-polyclonal-pld1-antibody-immunohistochemistry-paraffin-249202492654..jpg "Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] -Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] -Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/antibody/nbp2-34078_rabbit-polyclonal-pld1-antibody-immunohistochemistry-paraffin-249202492747..jpg "Immunohistochemistry-Paraffin: PLD1 Antibody [NBP2-34078] -Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")