Novus Biologicals products are now on bio-techne.com

NLRP11 Recombinant Protein Antigen

Images

 
There are currently no images for NLRP11 Protein (NBP1-92186PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

NLRP11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP11.

Source: E. coli

Amino Acid Sequence: HLGNDGVAKLLESLISPDCVLKVVGLPLTGLNTQTQQLLMTVKERKPSLIFLSETWSLKEGREIGVTPASQPGSIIPNSNLDYMFFKFPRMSAAMRTSNTASR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NLRP11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92186.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NLRP11 Recombinant Protein Antigen

  • CLR19.6
  • NACHT, leucine rich repeat and PYD containing 11
  • NALP11NACHT, LRR and PYD domains-containing protein 11
  • NLR family, pyrin domain containing 11
  • NOD17PYPAF7
  • Nucleotide-binding oligomerization domain protein 17
  • nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 11
  • PAAD- and NACHT-containing protein 10
  • PAAD- and NACHT-containing protein 10B
  • PAAD-and NACHT domain-containing protein 10
  • PAN10FLJ26273
  • PYPAF6NACHT, LRR and PYD containing protein 11
  • PYRIN-containing APAF1-like protein 6

Background

NALPs are cytoplasmic proteins that form a subfamily within the larger CATERPILLER protein family. Most short NALPs, such as NALP11, have an N-terminal pyrin (MEFV; MIM 608107) domain (PYD), followed by a NACHT domain, a NACHT-associated domain (NAD), and a C-terminal leucine-rich repeat (LRR) region. The long NALP, NALP1 (MIM 606636), also has a C-terminal extension containing a function to find domain (FIIND) and a caspase recruitment domain (CARD). NALPs are implicated in the activation of proinflammatory caspases (e.g., CASP1; MIM 147678) via their involvement in multiprotein complexes called inflammasomes (Tschopp et al., 2003 [PubMed 12563287]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56155
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NB600-809
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-76293
Species: Hu, Mu, Rt, V-Vi
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB6606
Species: Hu, Mu, Rt
Applications: WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56156
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP1-54899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF821
Species: Hu, Mu
Applications: WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB868
Species: Hu
Applications: WB
NBP1-92186PEP
Species: Hu
Applications: AC

Publications for NLRP11 Protein (NBP1-92186PEP) (0)

There are no publications for NLRP11 Protein (NBP1-92186PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NLRP11 Protein (NBP1-92186PEP) (0)

There are no reviews for NLRP11 Protein (NBP1-92186PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NLRP11 Protein (NBP1-92186PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NLRP11 Products

Research Areas for NLRP11 Protein (NBP1-92186PEP)

Find related products by research area.

Blogs on NLRP11.

The NLRP3 Inflammasome: Macrophage Activator & Pathology Driver
By Victoria Osinski, PhDWhat is the NLRP3 Inflammasome?With its critical role in innate immunity, the nucleotide-binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome ...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NLRP11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NLRP11