ISYNA1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA |
Predicted Species |
Mouse (93%), Rat (95%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ISYNA1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ISYNA1 Antibody
Background
ISYNA1 is a gene that codes for a protein which is a key enzyme in the myo-inositol biosynthesis pathway which works to convert a glucose 6-phosphate into a 1-myo-inositol 1-phosphate, as well as a rate-limiting enzyme in the synthesis of all compounds containing inositol, and is highly expressed in the testis, ovary, heart, placenta, and pancreas. ISYNA1 has three isoforms with lengths of 558, 430, and 504 amino acids and weights of approximately 61, 47, and 55 kDa respectively. Current studies are being done on several diseases and disorders relating to this gene including synostosis, Whipple disease, cerebral palsy, osteonecrosis, bipolar disorder, candidiasis, cerebtitis, osteoarthritis, and malaria. ISYNA1 has also been shown to have interactions with NME2, PPP2CA, RPS15A, CAP2, and EEF2 in pathways such as inositol phosphate metabolism pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for ISYNA1 Antibody (NBP2-47415) (0)
There are no publications for ISYNA1 Antibody (NBP2-47415).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ISYNA1 Antibody (NBP2-47415) (0)
There are no reviews for ISYNA1 Antibody (NBP2-47415).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ISYNA1 Antibody (NBP2-47415) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ISYNA1 Products
Research Areas for ISYNA1 Antibody (NBP2-47415)
Find related products by research area.
|
Blogs on ISYNA1