GM2A Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GM2A. Source: E. coli
Amino Acid Sequence: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
GM2A |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87090. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GM2A Recombinant Protein Antigen
Background
GM2A, also known as Ganglioside GM2 activator, is a 193 amino acid that is 21 kDa, with lysosome subcellular location, acts as s a lipid transfer protein that stimulates the enzymatic processing of gangliosides and T-cell activation; acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A which, together with this activator, catalyzes the degradation of the ganglioside GM2; also displays some calcium-independent phospholipase activity. Disease research on this protein has shown a relationship with tay-sachs disease, gangliosidosis, gangliosidosis gm2, sandhoff disease, neurological disorder, candidiasis, protein s deficiency, neurodegenerative disease, tay-sachs disease ab variant, spinal muscular atrophy, lysosomal storage disease, muscular atrophy, sinusitis, gastric cancer, cholesterol, and neuronitis. The GM2A protein has also shown an interaction with PLD2, GPLD1 and HEXA in the Sphingolipid metabolism, glycosphingolipid metabolism, lysosome, and phospholipid metabolism pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for GM2A Protein (NBP1-87090PEP) (0)
There are no publications for GM2A Protein (NBP1-87090PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GM2A Protein (NBP1-87090PEP) (0)
There are no reviews for GM2A Protein (NBP1-87090PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GM2A Protein (NBP1-87090PEP) (0)
Additional GM2A Products
Blogs on GM2A