![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human liver and cerebral cortex tissues using NBP1-85691 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0024.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human liver and cerebral cortex tissues using NBP1-85691 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CES1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Carboxylesterase 1/CES1 Antibody (NBP1-85691)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CES1 |
![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human cerebral cortex, liver, prostate and upper gastrointestinal using Anti-CES1 antibody NBP1-85691 (A) shows similar protein distribution across tissues to independent antibody NBP2-48854 (B).](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0022.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human cerebral cortex, liver, prostate and upper gastrointestinal using Anti-CES1 antibody NBP1-85691 (A) shows similar protein distribution across tissues to independent antibody NBP2-48854 (B).")
![Western Blot: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human cell line HepG2.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Western-Blot-NBP1-85691-img0008.jpg "Western Blot: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human cell line HepG2.")
![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0026.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0014.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0021.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.")
![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human lung shows strong cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0025.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human lung shows strong cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Immunohistochemistry-Paraffin-NBP1-85691-img0027.jpg "Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells.")
![Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Simple Western lane view shows a specific band for CES1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Simple-Western-NBP1-85691-img0006.jpg "Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Simple Western lane view shows a specific band for CES1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Electropherogram image(s) of corresponding Simple Western lane view. CES1 antibody was used at 1:20 dilution on RT-4 lysate(s).](http://images.novusbio.com/fullsize/Carboxylesterase-1-CES1-Antibody-Simple-Western-NBP1-85691-img0007.jpg "Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Electropherogram image(s) of corresponding Simple Western lane view. CES1 antibody was used at 1:20 dilution on RT-4 lysate(s).")
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")